Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Lipid-anchored plasma membrane protein CPP1 (CPP1)

Recombinant Saccharomyces cerevisiae Lipid-anchored plasma membrane protein CPP1 (CPP1)

Product Specifications

Product Name Alternative

C-terminally palmitoylated protein CPP1; Cysteine-rich protein CPP1

UniProt

P38216

Expression Region

2-128aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Metabolism Research; Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

82.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQERGYPPQQQQQYYQQQQQHPGYYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGHQQPVYVQQQPPQRGNEGCLAACLAALCICCTMDMLF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Map1lc3b (NM_022867) Rat Tagged ORF Clone
RR209172 10 µg

Map1lc3b (NM_022867) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal PSF3 Antibody
NBP3-12589-100ul 100 µL

Rabbit Polyclonal PSF3 Antibody

Sign In for Pricing
View Details
ANKRD17 Antibody - N-terminal region : FITC (ARP73745_P050-FITC)
ARP73745_P050-FITC 100 µL

ANKRD17 Antibody - N-terminal region : FITC (ARP73745_P050-FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal LRRC56 Antibody [Janelia Fluor 646]
NBP2-98195JF646 0.1 mL

Rabbit Polyclonal LRRC56 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
DSPE-PEG-PNA MW:2K
MPL0261K Each

DSPE-PEG-PNA MW:2K

Sign In for Pricing
View Details
TRPC5 293 Cell Lysate
401953 0.1 mg

TRPC5 293 Cell Lysate

Sign In for Pricing
View Details