Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tight junction protein 2 (TJP2), partial

Recombinant Human Tight junction protein 2 (TJP2), partial

Product Specifications

Product Name Alternative

Tight junction protein ZO-2; Zona occludens protein 2; Zonula occludens protein 2

UniProt

Q9UDY2

Expression Region

33-120aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Boc-(2S,3R,4E,11Z)-2-aminooctadeca-4,11-diene-1,3-diol
TRC-B602600-10MG 10 mg

N-Boc-(2S,3R,4E,11Z)-2-aminooctadeca-4,11-diene-1,3-diol

Sign In for Pricing
View Details
Purified Anti-Human CD85j Antibody[GHI/75]
AN002890P-01 25 µg

Purified Anti-Human CD85j Antibody[GHI/75]

Sign In for Pricing
View Details
Purified Anti-Human CD85j Antibody[GHI/75]
AN002890P-02 100 µg

Purified Anti-Human CD85j Antibody[GHI/75]

Sign In for Pricing
View Details
Octyl Maleimide
TRC-O290025-500MG 500 mg

Octyl Maleimide

Sign In for Pricing
View Details
Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) ELISA Kit
E-EL-M0834-01 24 Tests

Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) ELISA Kit
E-EL-M0834-02 48 Tests

Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details