Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tight junction protein 2 (TJP2), partial

Recombinant Human Tight junction protein 2 (TJP2), partial

Product Specifications

Product Name Alternative

Tight junction protein ZO-2; Zona occludens protein 2; Zonula occludens protein 2

UniProt

Q9UDY2

Expression Region

33-120aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit
MBS2802681-01 48 Tests

Goat Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit

Sign In for Pricing
View Details
Goat Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit
MBS2802681-02 96 Tests

Goat Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit

Sign In for Pricing
View Details
Goat Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit
MBS2802681-03 5x 96 Tests

Goat Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit

Sign In for Pricing
View Details
Goat Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit
MBS2802681-04 10x 96 Tests

Goat Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit

Sign In for Pricing
View Details
AMPK gamma1 Mouse Monoclonal Antibody (BF750)
orb2367330 100 µL

AMPK gamma1 Mouse Monoclonal Antibody (BF750)

Sign In for Pricing
View Details
IL20RA Antibody
orb518474-01 50 μL

IL20RA Antibody

Sign In for Pricing
View Details