Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731)

Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731)

Product Specifications

UniProt

P9WJ10

Expression Region

1-81aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RYBP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]
TA504652AM 100 µL

RYBP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]

Sign In for Pricing
View Details
PHF11 (NM_001040444) Human Over-expression Lysate
LC421762 20 µg

PHF11 (NM_001040444) Human Over-expression Lysate

Sign In for Pricing
View Details
HIG2 (HILPDA) Human Gene Knockout Kit (CRISPR)
KN200185RB 1 Kit

HIG2 (HILPDA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(Ethylthio)-1H-benzimidazole
TRC-E926885-250MG 250 mg

2-(Ethylthio)-1H-benzimidazole

Sign In for Pricing
View Details
3-Isopropoxybenzoic Acid
TRC-I918195-500MG 500 mg

3-Isopropoxybenzoic Acid

Sign In for Pricing
View Details
Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A6]
TA801678BM 100 µL

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A6]

Sign In for Pricing
View Details