Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731)

Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731)

Product Specifications

UniProt

P9WJ10

Expression Region

1-81aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentacosanoic Acid
TRC-P238193-50MG 50 mg

Pentacosanoic Acid

Sign In for Pricing
View Details
L-Carnitine Orotate
TRC-C184170-500MG 500 mg

L-Carnitine Orotate

Sign In for Pricing
View Details
Azadirachtin B
TRC-A797325-10MG 10 mg

Azadirachtin B

Sign In for Pricing
View Details
General Purpose Incubator BIGP-304
BIGP-304 1 Unit

General Purpose Incubator BIGP-304

Sign In for Pricing
View Details
Rat A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7) ELISA Kit
RD-ADAMTS7-Ra-01 96 Tests

Rat A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7) ELISA Kit

Sign In for Pricing
View Details
Rat A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7) ELISA Kit
RD-ADAMTS7-Ra-02 48 Tests

Rat A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7) ELISA Kit

Sign In for Pricing
View Details