Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial

Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial

Product Specifications

Product Name Alternative

PspA; spr0121

UniProt

Q8DRI0

Expression Region

199-319aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DAEEVAPQAKIAELENQVHRLEQELKEIDESESEDYAKEGFRAPLQSKLDAKKAKLSKLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAKKAELEKTEADLKKAVNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SLC45A3 Antibody
RC-16500-01 50 μL

Recombinant SLC45A3 Antibody

Sign In for Pricing
View Details
Recombinant SLC45A3 Antibody
RC-16500-02 100 µL

Recombinant SLC45A3 Antibody

Sign In for Pricing
View Details
Recombinant SLC45A3 Antibody
RC-16500-03 1 mL

Recombinant SLC45A3 Antibody

Sign In for Pricing
View Details
Monkey Transforming Growth Factor Alpha (TGFa) ELISA Kit
RD-TGFa-Si-01 96 Tests

Monkey Transforming Growth Factor Alpha (TGFa) ELISA Kit

Sign In for Pricing
View Details
Monkey Transforming Growth Factor Alpha (TGFa) ELISA Kit
RD-TGFa-Si-02 48 Tests

Monkey Transforming Growth Factor Alpha (TGFa) ELISA Kit

Sign In for Pricing
View Details
Ptgfrn Mouse Gene Knockout Kit (CRISPR)
KN514177 1 Kit

Ptgfrn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details