Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial

Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial

Product Specifications

Product Name Alternative

PspA; spr0121

UniProt

Q8DRI0

Expression Region

199-319aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DAEEVAPQAKIAELENQVHRLEQELKEIDESESEDYAKEGFRAPLQSKLDAKKAKLSKLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAKKAELEKTEADLKKAVNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS627980 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
L-Cysteine Ethyl Ester Hydrochloride
TRC-C995010-50G 50 g

L-Cysteine Ethyl Ester Hydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS800510 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
GRB 14 (GRB14) Human Gene Knockout Kit (CRISPR)
KN416110 1 Kit

GRB 14 (GRB14) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561944 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Nandrolone-13C2 Benzoate
TRC-N315006-25MG 25 mg

Nandrolone-13C2 Benzoate

Sign In for Pricing
View Details