Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial

Recombinant Streptococcus pneumoniae Surface protein pspA (pspA), Partial

Product Specifications

Product Name Alternative

PspA; spr0121

UniProt

Q8DRI0

Expression Region

199-319aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DAEEVAPQAKIAELENQVHRLEQELKEIDESESEDYAKEGFRAPLQSKLDAKKAKLSKLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAKKAELEKTEADLKKAVNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac 1,3-bis-stearoyl-2-bromopropanediol-d5
TRC-S454132-50MG 50 mg

rac 1,3-bis-stearoyl-2-bromopropanediol-d5

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (rATG5/2553), CF647 conjugate, 0.1mg/mL
BNC473642-500 1x 500 µL

ATG5 (Autophagy Marker) (rATG5/2553), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ionotropic glutamate receptor 2 + 3 Recombinant Rabbit Monoclonal Antibody [JE33-28]
HA721405 100 µL

Ionotropic glutamate receptor 2 + 3 Recombinant Rabbit Monoclonal Antibody [JE33-28]

Sign In for Pricing
View Details
Tal1 (TAL1/2707), CF405S conjugate, 0.1mg/mL
BNC042707-500 1x 500 µL

Tal1 (TAL1/2707), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Rat BNP (Brain Natriuretic Peptide) ELISA Kit
E-UNEL-R0090-01 5x 96 Tests

Uncoated Rat BNP (Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat BNP (Brain Natriuretic Peptide) ELISA Kit
E-UNEL-R0090-02 15x 96 Tests

Uncoated Rat BNP (Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details