Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acyrthosiphon pisum Odorant-binding protein 7 (obp7)

Recombinant Acyrthosiphon pisum Odorant-binding protein 7 (obp7)

Product Specifications

Product Name Alternative

Obp7

UniProt

C1KUY7

Expression Region

1-125aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Acyrthosiphon pisum (Pea aphid)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLSEAAIKKTQQMLKTVCSKKHSVEEDVFTNIKKGIFPEDNNNIKCYFACNFKTMQLINQKGVIDKKMFKDKMSMMAPPNVYKILLPVIEQCTGKDKGEELCQSSYNVIKCAHSVDPKSLEFLPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3, B-ATF-3, 21kD Small Nuclear Factor isolated from T-Cells, Jun Dimerization Protein p21SNFT, BATF3, SNFT) (Biotin)
MBS6454393-01 0.1 mL

BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3, B-ATF-3, 21kD Small Nuclear Factor isolated from T-Cells, Jun Dimerization Protein p21SNFT, BATF3, SNFT) (Biotin)

Sign In for Pricing
View Details
BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3, B-ATF-3, 21kD Small Nuclear Factor isolated from T-Cells, Jun Dimerization Protein p21SNFT, BATF3, SNFT) (Biotin)
MBS6454393-02 5x 0.1 mL

BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3, B-ATF-3, 21kD Small Nuclear Factor isolated from T-Cells, Jun Dimerization Protein p21SNFT, BATF3, SNFT) (Biotin)

Sign In for Pricing
View Details
N Cadherin (CDH2) Mouse Monoclonal Antibody [Clone ID: OTI4G1]
TA803323S 30 µL

N Cadherin (CDH2) Mouse Monoclonal Antibody [Clone ID: OTI4G1]

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Increased rDNA silencing protein 4 (IRS4) , partial
MBS1115225 Inquire

Recombinant Saccharomyces cerevisiae Increased rDNA silencing protein 4 (IRS4) , partial

Sign In for Pricing
View Details
Rac-Desmethoxycarbonyl Indoxacarb
464376-01 1 mg

Rac-Desmethoxycarbonyl Indoxacarb

Sign In for Pricing
View Details
Rac-Desmethoxycarbonyl Indoxacarb
464376-02 10 mg

Rac-Desmethoxycarbonyl Indoxacarb

Sign In for Pricing
View Details