Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acyrthosiphon pisum Odorant-binding protein3 (obp3)

Recombinant Acyrthosiphon pisum Odorant-binding protein3 (obp3)

Product Specifications

Product Name Alternative

Obp3

UniProt

C1KUY3

Expression Region

1-118aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Acyrthosiphon pisum (Pea aphid)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RFTTEQIDYYGKACNASEDDLVVVKSYKVPTTETGKCLMKCMITKLGLLNDDGSYNKTGMEAGLKKYWSEWSTEKIESINNKCYEEALLVSKEVVATCNYSYTVMACLNKQLDLDKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF18 Rabbit Polyclonal Antibody
TA367580 100 µL

TNFSF18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GABRG3 (NM_033223) Human Over-expression Lysate
LY403235 100 µg

GABRG3 (NM_033223) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Il17ra activation kit by CRISPRa
GA202129 1 Kit

Mouse Il17ra activation kit by CRISPRa

Sign In for Pricing
View Details
Human SH3PXD2B activation kit by CRISPRa
GA117238 1 Kit

Human SH3PXD2B activation kit by CRISPRa

Sign In for Pricing
View Details
Naloxone-3,14-diacetate
TRC-N285005-1MG 1 mg

Naloxone-3,14-diacetate

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL
BNC881859-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details