Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial, Biotinylated

Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial, Biotinylated

Product Specifications

Product Name Alternative

T-cell surface glycoprotein Lyt-2

UniProt

P01731

Expression Region

28-196aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A4gnt Mouse Gene Knockout Kit (CRISPR)
KN500553 1 Kit

A4gnt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GBP6 Rabbit Polyclonal Antibody
JOT-AP10131-01 20 µL

GBP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GBP6 Rabbit Polyclonal Antibody
JOT-AP10131-02 50 μL

GBP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GBP6 Rabbit Polyclonal Antibody
JOT-AP10131-03 100 µL

GBP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monkey Heat Shock Protein glycoprotein 96,HSP gp96 ELISA Kit
CN-02248M1 96T

Monkey Heat Shock Protein glycoprotein 96,HSP gp96 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal TRPM8 Antibody [DyLight 350]
NB200-145UV 0.1 mL

Rabbit Polyclonal TRPM8 Antibody [DyLight 350]

Sign In for Pricing
View Details