Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial, Biotinylated

Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial, Biotinylated

Product Specifications

Product Name Alternative

T-cell surface glycoprotein Lyt-2

UniProt

P01731

Expression Region

28-196aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF3A Rabbit pAb, Pacific Blue conjugated
orb2863900 100 µL

GTF3A Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
NUCB2 Rabbit Polyclonal Antibody (PE)
orb491174 100 µL

NUCB2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
SNRNP200 Human shRNA Lentiviral Particle (Locus ID 23020)
TL314634V 500 µL Each

SNRNP200 Human shRNA Lentiviral Particle (Locus ID 23020)

Sign In for Pricing
View Details
Mouse Monoclonal CD47 Antibody (B6H12.2) [HRP]
NBP2-31106H 0.1 mL

Mouse Monoclonal CD47 Antibody (B6H12.2) [HRP]

Sign In for Pricing
View Details
KCP2 shRNA Plasmid (m)
sc-146377-SH 20 µg

KCP2 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Lymphocyte Function Associated Antigen 1 Alpha ELISA Kit
MBS080118-01 48 Well

Mouse Lymphocyte Function Associated Antigen 1 Alpha ELISA Kit

Sign In for Pricing
View Details