Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD9 antigen (CD9), partial, Biotinylated

Recombinant Human CD9 antigen (CD9), partial, Biotinylated

Product Specifications

Product Name Alternative

5H9 antigen; Cell growth-inhibiting gene 2 protein; Leukocyte antigen MIC3; Motility-related protein; Tetraspanin-29; p24

UniProt

P21926

Expression Region

112-195aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lubabegron
BA5110-5 5 mg

Lubabegron

Sign In for Pricing
View Details
CAMK1D Rabbit Polyclonal Antibody (BF350)
orb2402348 100 µL

CAMK1D Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
SPRN Antibody
CSB-PA058370-01 50 μL

SPRN Antibody

Sign In for Pricing
View Details
SPRN Antibody
CSB-PA058370-02 100 µL

SPRN Antibody

Sign In for Pricing
View Details
M-CSF Receptor(Phospho-Tyr923) Rabbit Polyclonal Antibody
JOT-AP03515-01 20 µL

M-CSF Receptor(Phospho-Tyr923) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
M-CSF Receptor(Phospho-Tyr923) Rabbit Polyclonal Antibody
JOT-AP03515-02 50 μL

M-CSF Receptor(Phospho-Tyr923) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details