Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 (IL6)

Recombinant Human Interleukin-6 (IL6)

Product Specifications

Product Name Alternative

B-cell stimulatory factor 2; CTL differentiation factor; Hybridoma growth factor; Interferon beta-2

UniProt

P05231

Expression Region

30-212aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Syndecan-4 Antibody (008) [Alexa Fluor 532]
NBP2-90699AF532 0.1 mL

Rabbit Monoclonal Syndecan-4 Antibody (008) [Alexa Fluor 532]

Sign In for Pricing
View Details
Rabbit Anti-Human IgM Antibody (AF680)
abx142838-01 100 µL

Rabbit Anti-Human IgM Antibody (AF680)

Sign In for Pricing
View Details
Rabbit Anti-Human IgM Antibody (AF680)
abx142838-02 500 µL

Rabbit Anti-Human IgM Antibody (AF680)

Sign In for Pricing
View Details
Rabbit Anti-Human IgM Antibody (AF680)
abx142838-03 1 mL

Rabbit Anti-Human IgM Antibody (AF680)

Sign In for Pricing
View Details
ZNF488 antibody - C-terminal region (ARP39942_T100)
ARP39942_T100 100 µL

ZNF488 antibody - C-terminal region (ARP39942_T100)

Sign In for Pricing
View Details
5'-O-DMT-5-methyluridine
B-03-100MG 1 PC

5'-O-DMT-5-methyluridine

Sign In for Pricing
View Details