Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial

Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial

Product Specifications

Product Name Alternative

Cytokine receptor class-II member 8; Cytokine receptor family 2 member 8; IL-20R1; ZcytoR7

UniProt

Q9UHF4

Expression Region

30-250aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G patch domain-containing protein 1 (GPATCH1) Mouse ELISA Kit
D5444 96 Tests

G patch domain-containing protein 1 (GPATCH1) Mouse ELISA Kit

Sign In for Pricing
View Details
DMPK Colorimetric Cell-Based ELISA Kit (OKAG01304)
OKAG01304 96 Well

DMPK Colorimetric Cell-Based ELISA Kit (OKAG01304)

Sign In for Pricing
View Details
Rabbit Polyclonal Ornithine Carbamoyltransferase Antibody
NBP1-31582 100 µL

Rabbit Polyclonal Ornithine Carbamoyltransferase Antibody

Sign In for Pricing
View Details
Recombinant ACTL6A Antibody
RC-5605-01 50 μL

Recombinant ACTL6A Antibody

Sign In for Pricing
View Details
Recombinant ACTL6A Antibody
RC-5605-02 100 µL

Recombinant ACTL6A Antibody

Sign In for Pricing
View Details
Recombinant ACTL6A Antibody
RC-5605-03 1 mL

Recombinant ACTL6A Antibody

Sign In for Pricing
View Details