Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-2-microglobulin (B2M)

Recombinant Cat Beta-2-microglobulin (B2M)

Product Specifications

Product Name Alternative

B2M

UniProt

Q5MGS7

Expression Region

21-118aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VQHSPKVQVYSRHPAENGKPNFLNCYVSGFHPPQIDITLMKNGKKMEAEQTDLSFNRDWTFYLLVHTEFTPTVEDEYSCQVNHTTLSEPKVVKWDRDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S Transferase Alpha 2 (GSTa2), Recombinant, Mouse, His-Tag
057375-01 10 µg

Glutathione S Transferase Alpha 2 (GSTa2), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Glutathione S Transferase Alpha 2 (GSTa2), Recombinant, Mouse, His-Tag
057375-02 50 µg

Glutathione S Transferase Alpha 2 (GSTa2), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Glutathione S Transferase Alpha 2 (GSTa2), Recombinant, Mouse, His-Tag
057375-03 100 µg

Glutathione S Transferase Alpha 2 (GSTa2), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Glutathione S Transferase Alpha 2 (GSTa2), Recombinant, Mouse, His-Tag
057375-04 200 µg

Glutathione S Transferase Alpha 2 (GSTa2), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Lentiviral mouse Fau shRNA (UAS) - Lentiviral mouse Fau shRNA (UAS, RFP) plasmid
GTR15257845 1 Vial

Lentiviral mouse Fau shRNA (UAS) - Lentiviral mouse Fau shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
OR1A1 Rabbit pAb, AE conjugated
orb2851149 100 µL

OR1A1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details