Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serum amyloid A-2 protein (Saa2)

Recombinant Mouse Serum amyloid A-2 protein (Saa2)

Product Specifications

Product Name Alternative

Saa2

UniProt

P05367

Expression Region

20-122aa

Tag

N-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDB3 (NM_001080115) Human Untagged Clone
SC315738 10 µg

LDB3 (NM_001080115) Human Untagged Clone

Sign In for Pricing
View Details
Gm10369 3'UTR Luciferase Stable Cell Line
TU107258 1.0 mL

Gm10369 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
IL-1 RII Overexpression Lysate (Native) - (Dry Ice)
NBL1-11928 0.1 mg

IL-1 RII Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Research Grade Naxitamab Antibody
orb3152326-01 100 µg

Research Grade Naxitamab Antibody

Sign In for Pricing
View Details
Research Grade Naxitamab Antibody
orb3152326-02 1 mg

Research Grade Naxitamab Antibody

Sign In for Pricing
View Details
Butyryl-Histone H3 (Lys9) Rabbit Polyclonal Antibody
AG3983 50 µL

Butyryl-Histone H3 (Lys9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details