Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calcium-binding protein p22 (CHP1)

Recombinant Human Calcium-binding protein p22 (CHP1)

Product Specifications

Product Name Alternative

Calcineurin B-like protein; Calcium-binding protein CHP; Calcium-binding protein p22; EF-hand calcium-binding domain-containing protein p22

UniProt

Q99653

Expression Region

2-195aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KGF-2 Keratinocyte Growth Factor-2 Mouse Recombinant Protein
PROTO35565-01 5 µg

KGF-2 Keratinocyte Growth Factor-2 Mouse Recombinant Protein

Sign In for Pricing
View Details
KGF-2 Keratinocyte Growth Factor-2 Mouse Recombinant Protein
PROTO35565-02 1 mg

KGF-2 Keratinocyte Growth Factor-2 Mouse Recombinant Protein

Sign In for Pricing
View Details
κB-Ras2 siRNA (h)
sc-41798 10 µM

κB-Ras2 siRNA (h)

Sign In for Pricing
View Details
SUMO1 Antibody
V7067-100UG 100 µg

SUMO1 Antibody

Sign In for Pricing
View Details
EXTL1 siRNA (Human)
orb1866774-01 15 nmol

EXTL1 siRNA (Human)

Sign In for Pricing
View Details
EXTL1 siRNA (Human)
orb1866774-02 30 nmol

EXTL1 siRNA (Human)

Sign In for Pricing
View Details