Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium pasteurianum Rubredoxin

Recombinant Clostridium pasteurianum Rubredoxin

Product Specifications

Product Name Alternative

Rd

UniProt

P00268

Expression Region

1-54aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Clostridium pasteurianum

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFYVE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H7]
TA810112BM 100 µL

ZFYVE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H7]

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), 0.2mg/mL
BNUB0705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), 0.2mg/mL

Sign In for Pricing
View Details
Ecgonine Ethyl Ester
TRC-E325570-50MG 50 mg

Ecgonine Ethyl Ester

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
E-AB-19245-01 20 µL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
E-AB-19245-02 60 µL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
E-AB-19245-03 120 µL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details