Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Emericella nidulans Rodlet protein (rodA)

Recombinant Emericella nidulans Rodlet protein (rodA)

Product Specifications

Product Name Alternative

Rodlet protein A

UniProt

P28346

Expression Region

42-157aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPVPENVTVKQASDKCGDQAQLSCCNKATYAGDTTTVDEGLLSGALSGLIGAGSGAEGLGLFDQCSKLDVAVLIGIQDLVNQKCKQNIACCQNSPSSADGNLIGVGLPCVALGSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF594 conjugate, 0.1mg/mL
BNC942349-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), Biotin conjugate, 0.1mg/mL
BNCB0175-500 1x 500 µL

CD46 (122.2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF405S conjugate, 0.1mg/mL
BNC041619-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details