Recombinant Macaca fascicularis Interleukin-21 receptor (IL21R), partial (Active)
Recombinant Macaca fascicularis Interleukin-21 receptor (IL21R), partial (Active)
Product Specifications
Product Name Alternative
Interleukin-21 receptor; Novel interleukin receptor
UniProt
G7Q0S8
Expression Region
41-253aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
1Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL21R at 2 μg/mL can bind Human IL21. The EC50 is 15.01-19.43 ng/mL. 2Human IL21 captured on Protein A Chip can bind Recombinant Macaca fascicularis IL21R with an affinity constant of 1.31 nM as detected by MetaSPR Assay.
Form
Lyophilized powder
Molecular Weight
26.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNVTDHSGNYTQECGSFLLADSIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PerCP/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d379c/imageurl/e-ab-f1176j.webp)
E-AB-F1176J-01 50 Tests
PerCP/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]
Sign In for Pricing
View Details E-AB-F1176J-02 100 Tests
PerCP/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]
Sign In for Pricing
View Details E-AB-F1176J-03 2x 100 Tests
PerCP/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]
Sign In for Pricing
View Details 
BNC400198-100 1x 100 µL
Cytokeratin 18 (DA7), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-B446685-50MG 50 mg
2,2-Bis-(4-hydroxyphenyl)hexafluoropropane Monosulfate Sodium Salt
Sign In for Pricing
View Details