Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hemojuvelin (HJV) (Active)

Recombinant Human Hemojuvelin (HJV) (Active)

Product Specifications

Product Name Alternative

Hemojuvelin; Hemochromatosis type 2 protein; Hemojuvelin BMP coreceptor; RGM domain family member C

UniProt

Q6ZVN8

Expression Region

36-400aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human HJV at 2 μg/mL can bind Anti-HJV recombinant antibody. The EC50 is 0.7831-0.8801 ng/mL. 2HJV Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Human HJV with an affinity constant of 0.973 nM as detected by MetaSPR Assay.

Form

Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfyve9 sgRNA CRISPR Lentivector set (Mouse)
K3668201 3x 1.0 µg

Zfyve9 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
P4HB Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1476R-BF594-01 20 µL

P4HB Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
P4HB Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1476R-BF594-02 100 µL

P4HB Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ST3GAL6 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV656994 1.0 µg DNA

ST3GAL6 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
KLHL6 cDNA Clone
MBS1277617-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

KLHL6 cDNA Clone

Sign In for Pricing
View Details
KLHL6 cDNA Clone
MBS1277617-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

KLHL6 cDNA Clone

Sign In for Pricing
View Details