Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P-selectin (SELP) (V640L), partial (Active)

Recombinant Human P-selectin (SELP) (V640L), partial (Active)

Product Specifications

Product Name Alternative

P-selectin; CD62 antigen-like family member P; Granule membrane protein 140; GMP-140; Leukocyte-endothelial cell adhesion molecule 3; LECAM3; Platelet activation dependent granule-external membrane protein; PADGEM; CD antigen CD62P

UniProt

P16109

Expression Region

42-771aa (V640L)

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human SELP at 2 μg/mL can bind Anti-SELP recombinant antibody. The EC50 is 3.120-3.578 ng/mL. 2SELP Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Human SELP with an affinity constant of 0.956 nM as detected by MetaSPR Assay.

Form

Lyophilized powder

Molecular Weight

81.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS637084 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
TFAP2A Antibody
KC-1391-01 50 μL

TFAP2A Antibody

Sign In for Pricing
View Details
TFAP2A Antibody
KC-1391-02 100 µL

TFAP2A Antibody

Sign In for Pricing
View Details