Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Natriuretic peptides B (Nppb)

Recombinant Rat Natriuretic peptides B (Nppb)

Product Specifications

Product Name Alternative

Brain natriuretic factor prohormone; Gamma-brain natriuretic peptide; Iso-ANP

UniProt

P13205

Expression Region

27-121aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.266.

AA Sequence

HPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKI Rabbit Polyclonal Antibody
TA372292 100 µL

DGKI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRP1B Human Gene Knockout Kit (CRISPR)
KN224195LP 1 Kit

LRP1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD95 / FAS / TNFRSF6 (FAS/3112), CF405S conjugate, 0.1mg/mL
BNC043112-500 1x 500 µL

CD95 / FAS / TNFRSF6 (FAS/3112), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Hydroxyanisole
TRC-H750015-5G 5 g

4-Hydroxyanisole

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/2832R), Biotin conjugate, 0.1mg/mL
BNCB2832-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/2832R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
a-Pyrrolidinoisohexanophenone (Hydrochloride)
TRC-P841230-50MG 50 mg

a-Pyrrolidinoisohexanophenone (Hydrochloride)

Sign In for Pricing
View Details