Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Tonin (Klk2)

Recombinant Rat Tonin (Klk2)

Product Specifications

Product Name Alternative

Esterase 1; Glandular kallikrein-2; RSKG-5; S2 kallikrein

UniProt

P00759

Expression Region

25-259aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.265.

AA Sequence

IVGGYKCEKNSQPWQVAVINEYLCGGVLIDPSWVITAAHCYSNNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKENP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3BP2 (SH3 Domain-binding Protein 2, 3BP-2, 3BP2, RES4-23, FLJ42079) APC
MBS6139033-01 0.1 mL

SH3BP2 (SH3 Domain-binding Protein 2, 3BP-2, 3BP2, RES4-23, FLJ42079) APC

Sign In for Pricing
View Details
SH3BP2 (SH3 Domain-binding Protein 2, 3BP-2, 3BP2, RES4-23, FLJ42079) APC
MBS6139033-02 5x 0.1 mL

SH3BP2 (SH3 Domain-binding Protein 2, 3BP-2, 3BP2, RES4-23, FLJ42079) APC

Sign In for Pricing
View Details
Anti-Histone H3 (Zebrafish Specific) (2C4) Mouse Monoclonal Antibody
MA3026-.05 50 µL

Anti-Histone H3 (Zebrafish Specific) (2C4) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ACTL8, ID (ACTL8, Actin-like protein 8, Cancer/testis antigen 57) (APC) discontinued
031581-APC 200 µL

ACTL8, ID (ACTL8, Actin-like protein 8, Cancer/testis antigen 57) (APC) discontinued

Sign In for Pricing
View Details
MDM4 Antibody
orb572238 100 µL

MDM4 Antibody

Sign In for Pricing
View Details
S100A7 (S100 Calcium Binding Protein A7, PSOR1, S100A7c) (MaxLight 750)
MBS6240452-01 0.1 mL

S100A7 (S100 Calcium Binding Protein A7, PSOR1, S100A7c) (MaxLight 750)

Sign In for Pricing
View Details