Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)

Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)

Product Specifications

Product Name Alternative

Putative HeLa tumor suppressor

UniProt

Q8N2G4

Expression Region

21-117aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.227.

AA Sequence

LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr516 (NM_001000316) Rat Untagged Clone
RN212418 10 µg

Olr516 (NM_001000316) Rat Untagged Clone

Sign In for Pricing
View Details
AHR ELISA Kit (Human) (OKEH04834)
OKEH04834 96 Well

AHR ELISA Kit (Human) (OKEH04834)

Sign In for Pricing
View Details
CIC Lentiviral Vector (Mouse) (pLenti-GIII-CMV )
16169064 1.0 µg DNA

CIC Lentiviral Vector (Mouse) (pLenti-GIII-CMV )

Sign In for Pricing
View Details
Olr144 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7397607 1.0 µg DNA

Olr144 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Stat3 (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF) (BSA & Azide Free) (MaxLight 650) discontinued
S7971-01FX-ML650 100 µL

Stat3 (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF) (BSA & Azide Free) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Anti-MATK Rabbit pAb
GB112991-50 50 μL

Anti-MATK Rabbit pAb

Sign In for Pricing
View Details