Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor VIII (F8)

Recombinant Human Coagulation factor VIII (F8)

Product Specifications

Product Name Alternative

Antihemophilic factor; Procoagulant component

UniProt

P00451

Expression Region

1-216aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.218.

AA Sequence

MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Swine TNF alpha protein (His Tag)
PKSS000010-01 5 µg

Recombinant Swine TNF alpha protein (His Tag)

Sign In for Pricing
View Details
Recombinant Swine TNF alpha protein (His Tag)
PKSS000010-02 20 µg

Recombinant Swine TNF alpha protein (His Tag)

Sign In for Pricing
View Details
Oct4 (POU5F1) (NM_002701) Human Recombinant Protein
TP762703 50 µg

Oct4 (POU5F1) (NM_002701) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human EGF Protein (Fc Tag)
PKSH032002 100 µg

Recombinant Human EGF Protein (Fc Tag)

Sign In for Pricing
View Details
PR3 (PRTN3) Human Gene Knockout Kit (CRISPR)
KN420949 1 Kit

PR3 (PRTN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
M-CSF (CSF1) (NM_000757) Human Over-expression Lysate
LY424534 100 µg

M-CSF (CSF1) (NM_000757) Human Over-expression Lysate

Sign In for Pricing
View Details