Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial

Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial

Product Specifications

UniProt

P19909

Expression Region

291-497aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Streptococcus sp. group G

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.200.

AA Sequence

IDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD90 antibody
MO90PU(V500) 500 µg

CD90 antibody

Sign In for Pricing
View Details
APC anti-mouse CD115 (CSF-1R)
GT04006 100 µg

APC anti-mouse CD115 (CSF-1R)

Sign In for Pricing
View Details
Aif1, Recombinant, Rat, aa2-147, His-Tag (Allograft Inflammatory Factor 1)
372193-01 20 µg

Aif1, Recombinant, Rat, aa2-147, His-Tag (Allograft Inflammatory Factor 1)

Sign In for Pricing
View Details
Aif1, Recombinant, Rat, aa2-147, His-Tag (Allograft Inflammatory Factor 1)
372193-02 100 µg

Aif1, Recombinant, Rat, aa2-147, His-Tag (Allograft Inflammatory Factor 1)

Sign In for Pricing
View Details
SAPK4 (MAPK13) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12B2]
TA505878BM 100 µL

SAPK4 (MAPK13) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12B2]

Sign In for Pricing
View Details
Recombinant MARCKS Related Protein (MARCKSL1)
SIPL860Hu01-01 10 µg

Recombinant MARCKS Related Protein (MARCKSL1)

Sign In for Pricing
View Details