Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin beta C chain (INHBC)

Recombinant Human Inhibin beta C chain (INHBC)

Product Specifications

Product Name Alternative

Activin beta-C chain

UniProt

P55103

Expression Region

237-352aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

81.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.166.

AA Sequence

GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL
BNC470902-100 1x 100 µL

Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), CF568 conjugate, 0.1mg/mL
BNC680262-100 1x 100 µL

Human Lambda Light Chain (HP6054), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF568 conjugate, 0.1mg/mL
BNC680824-500 1x 500 µL

CD68 (LAMP4/824), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF405S conjugate, 0.1mg/mL
BNC040809-500 1x 500 µL

Cyclin D1 (CCND1/809), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF647 conjugate, 0.1mg/mL
BNC472807-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details