Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine receptor A2a (ADORA2A) -Detergent

Recombinant Human Adenosine receptor A2a (ADORA2A) -Detergent

Product Specifications

UniProt

P29274

Expression Region

1-412aa

Tag

N-terminal Flag-tagged and C-terminal Twin-Strep-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.164.

AA Sequence

MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BZW1 AAV siRNA Pooled Vector
13593161 1.0 µg

BZW1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
KLRG2 Protein Vector (Human) (pPM-C-HA)
25885021 500 ng

KLRG2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His)
CG01-01 10 µg

Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His)
CG01-02 50 µg

Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His)
CG01-03 500 µg

Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His)
CG01-04 1 mg

Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His)

Sign In for Pricing
View Details