Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2)

Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2)

Product Specifications

Product Name Alternative

Beta-2-globin; Hemoglobin beta-2 chain; Hemoglobin beta-minor chain

UniProt

P02089

Expression Region

2-147aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.156.

AA Sequence

VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL
BNC042013-100 1x 100 µL

CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD32 (Fc Gamma RIIa) (FCGR2A/479), CF594 conjugate, 0.1mg/mL
BNC940479-500 1x 500 µL

CD32 (Fc Gamma RIIa) (FCGR2A/479), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Phenyl-N-propylpentan-2-amine Hydrochloride
TRC-P321197-500MG 500 mg

1-Phenyl-N-propylpentan-2-amine Hydrochloride

Sign In for Pricing
View Details
Recombinant MERS-CoV Spike Protein (S1+S2 ECD, aa 1-1297, His Tag)
PKSV030236 100 µg

Recombinant MERS-CoV Spike Protein (S1+S2 ECD, aa 1-1297, His Tag)

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2864), CF405S conjugate, 0.1mg/mL
BNC042864-500 1x 500 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2864), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dry Bath Incubator BDIB-105
BDIB-105 1 Unit

Dry Bath Incubator BDIB-105

Sign In for Pricing
View Details