Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Androgen receptor (AR), partial

Recombinant Human Androgen receptor (AR), partial

Product Specifications

Product Name Alternative

Dihydrotestosterone receptor; Nuclear receptor subfamily 3 group C member 4

UniProt

P10275

Expression Region

551-919aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.107.

AA Sequence

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CBX5 Antibody
RC-4749-01 50 μL

Recombinant CBX5 Antibody

Sign In for Pricing
View Details
Recombinant CBX5 Antibody
RC-4749-02 100 µL

Recombinant CBX5 Antibody

Sign In for Pricing
View Details
Recombinant CBX5 Antibody
RC-4749-03 1 mL

Recombinant CBX5 Antibody

Sign In for Pricing
View Details
Tesk1 Mouse Gene Knockout Kit (CRISPR)
KN317419RB 1 Kit

Tesk1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NXF1 Recombinant Rabbit Monoclonal Antibody [JE40-63]
ET7109-12 100 µL

NXF1 Recombinant Rabbit Monoclonal Antibody [JE40-63]

Sign In for Pricing
View Details
Bis[2-(perfluorodecyl)ethyl] Phosphate
TRC-B516280-5MG 5 mg

Bis[2-(perfluorodecyl)ethyl] Phosphate

Sign In for Pricing
View Details