Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-1 alpha (IL1A)

Recombinant Bovine Interleukin-1 alpha (IL1A)

Product Specifications

UniProt

P08831

Expression Region

113-268aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.105.

AA Sequence

SAHYSFQSNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Distearoyl-sn-glycero-3-phosphorylglycerol
TRC-D479240-10MG 10 mg

1,2-Distearoyl-sn-glycero-3-phosphorylglycerol

Sign In for Pricing
View Details
TRIM31 Antibody
KC-16160-01 50 μL

TRIM31 Antibody

Sign In for Pricing
View Details
TRIM31 Antibody
KC-16160-02 100 µL

TRIM31 Antibody

Sign In for Pricing
View Details
TRIM31 Antibody
KC-16160-03 1 mL

TRIM31 Antibody

Sign In for Pricing
View Details
NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF488A conjugate, 0.1mg/mL
BNC882010-500 1x 500 µL

NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ILKAP activation kit by CRISPRa
GA113007 1 Kit

Human ILKAP activation kit by CRISPRa

Sign In for Pricing
View Details