Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arachis hypogaea Non-specific lipid-transfer protein

Recombinant Arachis hypogaea Non-specific lipid-transfer protein

Product Specifications

UniProt

B6CEX8

Expression Region

25-116aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Arachis hypogaea (Peanut)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.97.

AA Sequence

ISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRFAM7A Human Gene Knockout Kit (CRISPR)
KN207623BN 1 Kit

CHRFAM7A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Sumo 2 (SUMO2) activation kit by CRISPRa
GA104526 1 Kit

Human Sumo 2 (SUMO2) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human Copine-1/CPNE1 Protein (His Tag)
PKSH032279-01 10 µg

Recombinant Human Copine-1/CPNE1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Copine-1/CPNE1 Protein (His Tag)
PKSH032279-02 50 µg

Recombinant Human Copine-1/CPNE1 Protein (His Tag)

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD565162 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
PTPN5 (NM_001039970) Human Over-expression Lysate
LC421867 20 µg

PTPN5 (NM_001039970) Human Over-expression Lysate

Sign In for Pricing
View Details