Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prunus persica Peamaclein

Recombinant Prunus persica Peamaclein

Product Specifications

UniProt

P86888

Expression Region

1-63aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Prunus persica (Peach) (Amygdalus persica)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.95.

AA Sequence

GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM73B (MIGA2) (NM_032809) Human Recombinant Protein
TP303943M 100 µg

FAM73B (MIGA2) (NM_032809) Human Recombinant Protein

Sign In for Pricing
View Details
Olfactory Receptor Family 51 Subfamily I Member 1 (OR51I1) Antibody
abx324123-01 50 µg

Olfactory Receptor Family 51 Subfamily I Member 1 (OR51I1) Antibody

Sign In for Pricing
View Details
Olfactory Receptor Family 51 Subfamily I Member 1 (OR51I1) Antibody
abx324123-02 100 µg

Olfactory Receptor Family 51 Subfamily I Member 1 (OR51I1) Antibody

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae trpR Protein (aa 1-101) (strain PittEE)
VAng-Lsx03922-1mgEcoli 1 mg (E. coli)

Recombinant Haemophilus Influenzae trpR Protein (aa 1-101) (strain PittEE)

Sign In for Pricing
View Details
BTC Antibody (N-term)
MBS9203607-01 0.08 mL

BTC Antibody (N-term)

Sign In for Pricing
View Details
BTC Antibody (N-term)
MBS9203607-02 0.4 mL

BTC Antibody (N-term)

Sign In for Pricing
View Details