Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prunus persica Peamaclein

Recombinant Prunus persica Peamaclein

Product Specifications

UniProt

P86888

Expression Region

1-63aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Prunus persica (Peach) (Amygdalus persica)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.95.

AA Sequence

GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD048 rabbit pAb
E44H13036 100 µL

CD048 rabbit pAb

Sign In for Pricing
View Details
ENC1 Protein Vector (Human) (pPM-C-His)
PV014236 500 ng

ENC1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human tubular basement membrane antibogy, TBM ELISA Kit
NB-E11152-01 96 Well

Human tubular basement membrane antibogy, TBM ELISA Kit

Sign In for Pricing
View Details
Human tubular basement membrane antibogy, TBM ELISA Kit
NB-E11152-02 96 Well

Human tubular basement membrane antibogy, TBM ELISA Kit

Sign In for Pricing
View Details
Anti-Histone deacetylase 2 HDAC2 Antibody Picoband® Fluoro488 Conjugated
PA1350-Fluoro488 100 µg/Vial

Anti-Histone deacetylase 2 HDAC2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
LIME1 Antibody (C-term) [APR03931G]
APR03931G-01 50 µL

LIME1 Antibody (C-term) [APR03931G]

Sign In for Pricing
View Details