Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prunus persica Peamaclein

Recombinant Prunus persica Peamaclein

Product Specifications

UniProt

P86888

Expression Region

1-63aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Prunus persica (Peach) (Amygdalus persica)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.95.

AA Sequence

GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3B Recombinant Antibody
bsm-62337R-01 20 µL

EIF3B Recombinant Antibody

Sign In for Pricing
View Details
EIF3B Recombinant Antibody
bsm-62337R-02 100 µL

EIF3B Recombinant Antibody

Sign In for Pricing
View Details
ADAM32 Protein Vector (Human) (pPM-N-D-C-His)
PV319793 500 ng

ADAM32 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
MBS1038870-01 0.02 mg (E-Coli)

Recombinant Vibrio fischeri UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
MBS1038870-02 0.02 mg (Yeast)

Recombinant Vibrio fischeri UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

Sign In for Pricing
View Details
Recombinant Vibrio fischeri UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
MBS1038870-03 0.1 mg (E-Coli)

Recombinant Vibrio fischeri UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

Sign In for Pricing
View Details