Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Beta-defensin 6 (DEFB6)

Recombinant Bovine Beta-defensin 6 (DEFB6)

Product Specifications

Product Name Alternative

BNBD-6; BNDB-6

UniProt

P46164

Expression Region

1-42aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.84.

AA Sequence

QGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF740 conjugate, 0.1mg/mL
BNC741784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (5.8A + MYD712), CF568 conjugate, 0.1mg/mL
BNC680713-100 1x 100 µL

MyoD1 (5.8A + MYD712), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF740 conjugate, 0.1mg/mL
BNC742224-100 1x 100 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF488A conjugate, 0.1mg/mL
BNC881868-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF488A conjugate, 0.1mg/mL
BNC881779-100 1x 100 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details