Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Osteopontin (SPP1), partial

Recombinant Human Osteopontin (SPP1), partial

Product Specifications

Product Name Alternative

Bone sialoprotein 1; Nephropontin; Secreted phosphoprotein 1; Urinary stone protein; Uropontin

UniProt

P10451

Expression Region

17-168aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.80.

AA Sequence

IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP-S12 Polyclonal Antibody
MBS9244368-01 0.1 mL

MRP-S12 Polyclonal Antibody

Sign In for Pricing
View Details
MRP-S12 Polyclonal Antibody
MBS9244368-02 5x 0.1 mL

MRP-S12 Polyclonal Antibody

Sign In for Pricing
View Details
WDR77 (Methylosome Protein 50, MEP-50, WD Repeat-containing Protein 77, Androgen Receptor Cofactor p44, p44/Mep50, MEP50, WD Repeat Domain 77) (Azide Free) (MaxLight 405) discontinued
W1007-99-ML405 100 µL

WDR77 (Methylosome Protein 50, MEP-50, WD Repeat-containing Protein 77, Androgen Receptor Cofactor p44, p44/Mep50, MEP50, WD Repeat Domain 77) (Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
DCTN5 Antibody; FITC conjugated
MBS7001676-01 0.05 mg

DCTN5 Antibody; FITC conjugated

Sign In for Pricing
View Details
DCTN5 Antibody; FITC conjugated
MBS7001676-02 0.1 mg

DCTN5 Antibody; FITC conjugated

Sign In for Pricing
View Details
DCTN5 Antibody; FITC conjugated
MBS7001676-03 5x 0.1 mg

DCTN5 Antibody; FITC conjugated

Sign In for Pricing
View Details