Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium pasteurianum Rubredoxin, Biotinylated

Recombinant Clostridium pasteurianum Rubredoxin, Biotinylated

Product Specifications

UniProt

P00268

Expression Region

1-54aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Clostridium pasteurianum

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.77.

AA Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Uba3 / NEDD8-activating enzyme E1 catalytic subunit Recombinant Protein
R1027r 1 Each

Rat Uba3 / NEDD8-activating enzyme E1 catalytic subunit Recombinant Protein

Sign In for Pricing
View Details
SQSTM1/p62 (Phospho-Ser403) Antibody
orb397182-01 50 μL

SQSTM1/p62 (Phospho-Ser403) Antibody

Sign In for Pricing
View Details
SQSTM1/p62 (Phospho-Ser403) Antibody
orb397182-02 100 µL

SQSTM1/p62 (Phospho-Ser403) Antibody

Sign In for Pricing
View Details
FTHL21 3'UTR GFP Stable Cell Line
TU058343 1.0 mL

FTHL21 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
E2F6 Rabbit mAb (AMR12536N)
AMR12536N-01 50 µL

E2F6 Rabbit mAb (AMR12536N)

Sign In for Pricing
View Details
E2F6 Rabbit mAb (AMR12536N)
AMR12536N-02 100 µL

E2F6 Rabbit mAb (AMR12536N)

Sign In for Pricing
View Details