Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium pasteurianum Rubredoxin, Biotinylated

Recombinant Clostridium pasteurianum Rubredoxin, Biotinylated

Product Specifications

UniProt

P00268

Expression Region

1-54aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Clostridium pasteurianum

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.77.

AA Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COBRA1, ID (COBRA1, KIAA1182, NELFB, Negative elongation factor B, Cofactor of BRCA1) (MaxLight 750) discontinued
034069-ML750 100 µL

COBRA1, ID (COBRA1, KIAA1182, NELFB, Negative elongation factor B, Cofactor of BRCA1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MEL-1A-R (B-10) : m-IgG Fc BP-HRP Bundle
sc-530127 1 Kit

MEL-1A-R (B-10) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Porcine Angiotensinase A ELISA Kit
MBS754513-01 48 Well

Porcine Angiotensinase A ELISA Kit

Sign In for Pricing
View Details
Porcine Angiotensinase A ELISA Kit
MBS754513-02 96 Well

Porcine Angiotensinase A ELISA Kit

Sign In for Pricing
View Details
Porcine Angiotensinase A ELISA Kit
MBS754513-03 5x 96 Well

Porcine Angiotensinase A ELISA Kit

Sign In for Pricing
View Details
Porcine Angiotensinase A ELISA Kit
MBS754513-04 10x 96 Well

Porcine Angiotensinase A ELISA Kit

Sign In for Pricing
View Details