Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Product Specifications

Product Name Alternative

68 kDa TATA-binding protein-associated factor; RNA-binding protein 56

UniProt

Q92804

Expression Region

1-109aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.71.

AA Sequence

MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl b-L-daunosaminide HCl
293981-01 25 mg

Methyl b-L-daunosaminide HCl

Sign In for Pricing
View Details
Methyl b-L-daunosaminide HCl
293981-02 50 mg

Methyl b-L-daunosaminide HCl

Sign In for Pricing
View Details
Methyl b-L-daunosaminide HCl
293981-03 100 mg

Methyl b-L-daunosaminide HCl

Sign In for Pricing
View Details
Methyl b-L-daunosaminide HCl
293981-04 250 mg

Methyl b-L-daunosaminide HCl

Sign In for Pricing
View Details
BTBD19 Rabbit Polyclonal Antibody (BF405)
orb2383924 100 µL

BTBD19 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Itfg1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3890902 1.0 µg DNA

Itfg1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details