Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-9 (LGALS9)

Recombinant Human Galectin-9 (LGALS9)

Product Specifications

Product Name Alternative

Ecalectin; Tumor antigen HOM-HD-21

UniProt

O00182

Expression Region

1-355aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.69.

AA Sequence

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPD3
520055-01 100 µL

AMPD3

Sign In for Pricing
View Details
AMPD3
520055-02 200 µL

AMPD3

Sign In for Pricing
View Details
p70 S6 Kinase Blocking Peptide
MBS9626282-01 1 mg

p70 S6 Kinase Blocking Peptide

Sign In for Pricing
View Details
p70 S6 Kinase Blocking Peptide
MBS9626282-02 5x 1 mg

p70 S6 Kinase Blocking Peptide

Sign In for Pricing
View Details
SERPINB10 sgRNA CRISPR Lentivector set (Human)
K2125101 3x 1.0 µg

SERPINB10 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human ENKUR sgRNA gene knockout kit - Lentiviral human ENKUR sgRNA gene knockout kit (25)
GTR15388041 1 Vial

Lentiviral human ENKUR sgRNA gene knockout kit - Lentiviral human ENKUR sgRNA gene knockout kit (25)

Sign In for Pricing
View Details