Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 8 (MSTN)

Recombinant Human Growth/differentiation factor 8 (MSTN)

Product Specifications

Product Name Alternative

Myostatin

UniProt

O14793

Expression Region

24-375aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.61.

AA Sequence

NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D1 Recombinant Antibody, Cy5 Conjugated
bsm-62684R-Cy5 100 µL

UBE2D1 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal CrkRS Antibody [Alexa Fluor 700]
NB100-87011AF700 0.1 mL

Rabbit Polyclonal CrkRS Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Hsa-miR-548u miRNA Agomir
orb1920629-01 5 nmol

Hsa-miR-548u miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-548u miRNA Agomir
orb1920629-02 10 nmol

Hsa-miR-548u miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-548u miRNA Agomir
orb1920629-03 20 nmol

Hsa-miR-548u miRNA Agomir

Sign In for Pricing
View Details
Mettl11b (NM_001143956) Mouse Tagged Lenti ORF Clone
MR221326L3 10 µg

Mettl11b (NM_001143956) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details