Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-18-binding protein (IL18BP)

Recombinant Human Interleukin-18-binding protein (IL18BP)

Product Specifications

Product Name Alternative

Tadekinig-alfa

UniProt

O95998

Expression Region

31-194aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.59.

AA Sequence

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr521 shRNA (m) Lentiviral Particles
sc-150909-V 200 µL

Olfr521 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
pCMV-6×His-PTPN13-2-Neo Plasmid
PVT50335 2 µg

pCMV-6×His-PTPN13-2-Neo Plasmid

Sign In for Pricing
View Details
selO Antibody
MBS7171199 Inquire

selO Antibody

Sign In for Pricing
View Details
PSD-95 Antibody, Clone 7E3: ATTO 594
SMC-123D-A594 100 µg

PSD-95 Antibody, Clone 7E3: ATTO 594

Sign In for Pricing
View Details
Magic™ Membrane Protein Human CDH1 (Cadherin 1) Full Length
MPC1737K Each

Magic™ Membrane Protein Human CDH1 (Cadherin 1) Full Length

Sign In for Pricing
View Details
Crb1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3864002 1.0 µg DNA

Crb1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details