Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon gamma (Ifng)

Recombinant Mouse Interferon gamma (Ifng)

Product Specifications

UniProt

P01580

Expression Region

23-155aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.55.

AA Sequence

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Endothelial NOS (eNOS) ELISA Kit
EKN47426 96 Tests

Rat Endothelial NOS (eNOS) ELISA Kit

Sign In for Pricing
View Details
SOWAHC Antibody - C-terminal region : HRP (ARP67364_P050-HRP)
ARP67364_P050-HRP 100 µL

SOWAHC Antibody - C-terminal region : HRP (ARP67364_P050-HRP)

Sign In for Pricing
View Details
Mouse F box/LRR repeat protein 12 (FBXL12) ELISA Kit
GTR10366920 96 Well

Mouse F box/LRR repeat protein 12 (FBXL12) ELISA Kit

Sign In for Pricing
View Details
HIST1H2BN Adenovirus (Human)
23348052 1.0 mL

HIST1H2BN Adenovirus (Human)

Sign In for Pricing
View Details
RANGAP1 Antibody
orb18635 100 µg

RANGAP1 Antibody

Sign In for Pricing
View Details
PLEKHA9 Recombinant Protein (Human)
RP023770 100 µg

PLEKHA9 Recombinant Protein (Human)

Sign In for Pricing
View Details