Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon gamma (Ifng)

Recombinant Mouse Interferon gamma (Ifng)

Product Specifications

UniProt

P01580

Expression Region

23-155aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.55.

AA Sequence

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A2 3'UTR GFP Stable Cell Line
TU056615 1.0 mL

EEF1A2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Slc9a4 Pre-designed siRNA Set B
SI213264B 1 Each

Rat Slc9a4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CAP-D3 (CAP-6, KIAA0056, MGC104671) (Biotin) discontinued
C1075-91-Biotin 100 µL

CAP-D3 (CAP-6, KIAA0056, MGC104671) (Biotin) discontinued

Sign In for Pricing
View Details
Fbxo8 siRNA Oligos set (Rat)
20346176 3x 5 nmol

Fbxo8 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
GRIN1 Antibody
orb3161064-01 50 µL

GRIN1 Antibody

Sign In for Pricing
View Details
GRIN1 Antibody
orb3161064-02 100 µL

GRIN1 Antibody

Sign In for Pricing
View Details