Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prolactin (Prl)

Recombinant Mouse Prolactin (Prl)

Product Specifications

UniProt

P06879

Expression Region

30-226aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.54.

AA Sequence

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aromatase/CYP19A1 Rabbit Polyclonal Antibody (Carrier-free)
orb3082890 100 µg

Aromatase/CYP19A1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Mouse Cyth1 Pre-designed siRNA Set A
SI103348A 1 Each

Mouse Cyth1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
HA/Hemagglutinin, H3N2 (EPI537015, sf9, His)
HY-P75083 1 Each

HA/Hemagglutinin, H3N2 (EPI537015, sf9, His)

Sign In for Pricing
View Details
PPP2R1A Rabbit Polyclonal Antibody
orb865557 100 µg

PPP2R1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDX1, phosphorylated (T11) (PDX1, IPF1, Pancreas/duodenum homeobox protein 1, Glucose-sensitive factor, Insulin promoter factor 1, Insulin upstream factor 1, Islet/duodenum homeobox-1, Somatostatin-transactivating factor 1) (Biotin) discontinued
039857-Biotin 200 µL

PDX1, phosphorylated (T11) (PDX1, IPF1, Pancreas/duodenum homeobox protein 1, Glucose-sensitive factor, Insulin promoter factor 1, Insulin upstream factor 1, Islet/duodenum homeobox-1, Somatostatin-transactivating factor 1) (Biotin) discontinued

Sign In for Pricing
View Details
2810453I06Rik Recombinant Protein (Mouse)
RP111443 100 µg

2810453I06Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details