Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Folate receptor 2 (fetal) (FOLR1)

Recombinant Pig Folate receptor 2 (fetal) (FOLR1)

Product Specifications

UniProt

A0A8D1D1N2

Expression Region

21-249aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.52.

AA Sequence

ARPDLLNICMDAKHHKTKPGPEDGLHEQCSPWEMNACCSVNTSQEAHNDISYLYKFNWEHCGKMKPACKRHFIQDTCLYECSPNLGPWIQEVNQKWRRERILNVPLCKEDCQNWWEDCRTSYTCKSNWHEGWNWSSGYNRCPANAACHPFDFYFPTPAALCSQIWSNSYKQSNYSRGSGRCIQMWFDPEQGNPNEVVARYYAQIMSGAGLSEAWPLQFGLALTLLWLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-100 1x 100 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-500 1x 500 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF740 conjugate, 0.1mg/mL
BNC741619-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF640R conjugate, 0.1mg/mL
BNC400021-500 1x 500 µL

Cytokeratin 18 (DC10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details