Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Lepti (LEP)

Recombinant Pig Lepti (LEP)

Product Specifications

Product Name Alternative

Obesity factor

UniProt

Q29406

Expression Region

22-167aa

Tag

C-terminal mFc2a-tagged

Source

Mammalian cell

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.22.

AA Sequence

VPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RGS4 Polyclonal Antibody
TMAB-12229-01 50 μL

Anti-RGS4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RGS4 Polyclonal Antibody
TMAB-12229-02 100 µL

Anti-RGS4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RGS4 Polyclonal Antibody
TMAB-12229-03 200 µL

Anti-RGS4 Polyclonal Antibody

Sign In for Pricing
View Details
BMPR1A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0188607 1.0 µg DNA

BMPR1A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ZNF205 Antibody (N-term)
E45R31844G-1 100 µL

ZNF205 Antibody (N-term)

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 8 (MMP8) ELISA Kit
MBS4501110-01 48 Tests

Human Matrix Metalloproteinase 8 (MMP8) ELISA Kit

Sign In for Pricing
View Details